PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9556g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 449aa    MW: 50274.2 Da    PI: 5.5328
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9556g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.8e-093794122255
                   SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
      Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    +yps++e+  LA+ +gL+++q+ +WF N+R ++
  MA_9556g0010 379 WPYPSETEKIALAECTGLDQKQINNWFINQRKRH 412
                   58*****************************885 PP

2ELK38.72.1e-13332353122
           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                   ELK++Llr YsgyL+sLkqEF+
  MA_9556g0010 332 ELKDHLLRRYSGYLSSLKQEFM 353
                   9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.2E-19187231IPR005540KNOX1
PfamPF037903.7E-21188229IPR005540KNOX1
SMARTSM012568.0E-24235286IPR005541KNOX2
PfamPF037912.0E-22238284IPR005541KNOX2
PROSITE profilePS5121311.313332352IPR005539ELK domain
SMARTSM011886.1E-8332353IPR005539ELK domain
PfamPF037895.8E-11332353IPR005539ELK domain
PROSITE profilePS5007112.115352415IPR001356Homeobox domain
SuperFamilySSF466891.67E-18354429IPR009057Homeodomain-like
SMARTSM003892.6E-12354419IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-27357417IPR009057Homeodomain-like
CDDcd000861.52E-11364416No hitNo description
PfamPF059203.2E-15372411IPR008422Homeobox KN domain
PROSITE patternPS000270390413IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MEHLNTAAAQ ASSSLYGVGM AEYGDAGVSS LYGVGMAEYG DAGVSSMMAL ITQHEPHDSE  60
SIMSTRMPSS FSSFHGHADC LLSAAMFQAS QGDHKLKRQP GMDQLVSEQA GMSDSSMPSV  120
KTEVCSGLRN QFEFHREQTG NCYTDQSSNT PVNPLVTSLA SQARGEAQMI PSLDANSPHF  180
NVDNEEYAIK SKILAHPQYP SLLGAYIDCQ KIGAPPEAVA RLDALTREYQ NQQRRTVSIG  240
MDPELDQFME AYCEILTKYH EELAKPFKEA MTFLMKIEAQ FNSLGKGTIR ISPPAENDEK  300
TEGGGSSEEV EDGSGGETDF QEVDHHAVED RELKDHLLRR YSGYLSSLKQ EFMKKKKKGK  360
LPKDARQKLL DWWSLHDKWP YPSETEKIAL AECTGLDQKQ INNWFINQRK RHWKPSEDMH  420
FMVMNSHSPH SAALYVERHL MTEGYHLDC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1054970.0BT105497.1 Picea glauca clone GQ02823_G18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.11e-112PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-110KN1_SOLLC; Homeotic protein knotted-1
TrEMBLQ9ZR910.0Q9ZR91_PICMA; Homeobox transcription factor SKN1
STRINGVIT_18s0001g08380.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-79KNOTTED-like from Arabidopsis thaliana